Question: What Is The Concept Of Drafting?

What is meant by drafting?

Drafting (writing), writing something that is likely to be amended.

Technical drawing, the act and discipline of composing diagrams that communicates how something functions or is to be constructed.

E.g.: Architectural drawing..

What is the purpose of drafting?

During the drafting stage of writing, a student develops a more cohesive text and explores their topic, directed by purpose, audience, genre, and content. Drafting helps students expand upon, clarify, and modify their initial plans and ideas, and it helps them organize their content into a meaningful sequence or flow.

Which word best defines drafting?

Wiktionary. drafting(Noun) The act or process of producing a technical drawing, or draft. drafting(Noun) The art of producing technical drawings.

How do you do drafting?

Drafting Legal Documents, Principles of Clear WritingWrite in the active voice. The active voice eliminates confusion by forcing you to name the actor in a sentence. … Use action verbs. Avoid words like this: … Use “must” instead of “shall”. shall. … Be direct. … Use the present tense. … Write positively. … Avoid use of exceptions. … Avoid split infinitives.More items…

What is another word for drafting?

What is another word for drafting?composingframingcraftingdesigningdevisingdrawingplanningproducingsketchingwriting10 more rows

What are the types of drafting?

The major kinds of drafting are furniture drafting, architectural drafting, mechanical or machine drafting, electrical and electronics drafting, topographical drafting, airplane drafting, ship or naval drafting, structural drafting and sheet-metal drafting.

What are good drafting skills?

Although mastering legal drafting takes time and practice, superior writing skills are essential to success, and you can take steps to improve yours.Remember Your Audience. Robert Daly/Caiaimage/Getty Images. … Organize Your Writing. … Ditch The Legalese. … Be Concise. … Use Action Words. … Avoid Passive Voice. … Edit Ruthlessly.

Some Do’s and Don’ts of Drafting:Use familiar words rather than farfetched words.Use short words rather than a long word.Use Active voice instead of passive voice.No unnecessary repetition of words.Write shorter sentences.Express the ideas in fewer words.Choose the right word.More items…•

What is the opposite of draft?

What is the opposite of draft?cullrejectcuteliminaterebuffsnubspurnexcluderule out

What does draft mean in history?

ConscriptionConscription is the mandatory enlistment in a country’s armed forces, and is sometimes referred to as “the draft.” The origins of military conscription date back thousands of years to ancient Mesopotamia, but the first modern draft occurred during the French Revolution in the 1790s.